PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN36775.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 380aa    MW: 42432.6 Da    PI: 8.7546
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN36775.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.63.2e-191360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+d+++++G g W+t ++  g++R++k+c++rw +yl
       KHN36775.1 13 KGPWTPEEDQKLIDYIQKHGHGKWRTLPKNAGLKRCGKSCRLRWANYL 60
                     79********************************************97 PP

2Myb_DNA-binding53.94.1e-1766110147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W+tIa+ ++ gRt++++k++w+++
       KHN36775.1  66 RGRFSFEEEEAIIQLHSVLGNK-WSTIAANLP-GRTDNEIKNYWNTH 110
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-25663IPR009057Homeodomain-like
PROSITE profilePS5129419.358860IPR017930Myb domain
SuperFamilySSF466891.91E-3110107IPR009057Homeodomain-like
SMARTSM007172.0E-151262IPR001005SANT/Myb domain
PfamPF002493.4E-171360IPR001005SANT/Myb domain
CDDcd001671.05E-121560No hitNo description
PROSITE profilePS5129426.1261115IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-2664115IPR009057Homeodomain-like
SMARTSM007173.4E-1665113IPR001005SANT/Myb domain
PfamPF002491.1E-1466110IPR001005SANT/Myb domain
CDDcd001675.47E-1268111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MAKSSTEKNG LKKGPWTPEE DQKLIDYIQK HGHGKWRTLP KNAGLKRCGK SCRLRWANYL  60
RPDIKRGRFS FEEEEAIIQL HSVLGNKWST IAANLPGRTD NEIKNYWNTH IKKKLLKMGI  120
DPVTHTPRLD VIQLASILNT SLYNSAPQFN YPSLSGIGRS VINPSHMLGL LTTLLSCQNR  180
NYNPDVLNNN QLSGGSTLLQ NQHQCSRMQL DSTQAFQPNQ PQVSLQENHI AKSNSNPLNM  240
EPQVMKTTLE NQITPIATPF SQQNTLPNLW HYNTEGHISD LPTMAQSSSA MQCFSSPKFN  300
SIYNNLLENQ NLCNNNEGMP NFNLSSLLSS TPSSSSPIST LNSSSSTTFV NGTTEDERDT  360
YGSSMLMYNI SNGLNDSGLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-31111155108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0312010.0KT031201.1 Glycine max clone HN_CCL_73 MYB/HD-like transcription factor (Glyma12g34650.2) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003541861.10.0PREDICTED: myb-related protein 308-like
TrEMBLA0A0B2RUU80.0A0A0B2RUU8_GLYSO; Transcription factor MYB39
TrEMBLK7M2E60.0K7M2E6_SOYBN; Uncharacterized protein
STRINGGLYMA13G35810.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF151201013
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.19e-90MYB-like 102
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]